Structure of PDB 1fpt Chain L Binding Site BS01

Receptor Information
>1fpt Chain L (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLSLPVSLGDQASISCSSSQSLVHSNGKTYLHWYLQKPGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQSTHVP
YTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSEVQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRNEC
Ligand information
>1fpt Chain P (length=11) Species: 12081 (Human poliovirus 1 Mahoney) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DNPASTTNKDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fpt Structure of the complex between the Fab fragment of a neutralizing antibody for type 1 poliovirus and its viral epitope.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H27D K30 Y32 S91
Binding residue
(residue number reindexed from 1)		H31 K35 Y37 S96
External links