Structure of PDB 1ejo Chain L Binding Site BS01

Receptor Information
>1ejo Chain L (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKL
LIYRASNLESGIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPL
TFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
RWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRA
Ligand information
>1ejo Chain P (length=13) Species: 12121 (Foot-and-mouth disease virus C1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTTSTRGDLAHVT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ejo A multiply substituted G-H loop from foot-and-mouth disease virus in complex with a neutralizing antibody: a role for water molecules.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y2032 F2036 N2096 E2097 D2098 L2100
Binding residue
(residue number reindexed from 1)		Y32 F36 N96 E97 D98 L100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ejo, PDBe:1ejo, PDBj:1ejo
PDBsum1ejo
PubMed10811933
UniProtP01660|KV3A8_MOUSE Ig kappa chain V-III region PC 3741/TEPC 111

[Back to BioLiP]