Structure of PDB 1brn Chain L Binding Site BS01

Receptor Information

>1brn Chain L (length=108) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIG
GDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDH
YQTFTKIR

Ligand information

>1brn Chain A (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1brn Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76-A resolution.
Resolution	1.76 Å
Binding residue (original residue number in PDB)	K27 A37 S38 F56 S57 N58 R59 E60 E73 R83 N84 S85 R87 H102 Y103
Binding residue (residue number reindexed from 1)	K25 A35 S36 F54 S55 N56 R57 E58 E71 R81 N82 S83 R85 H100 Y101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004521	RNA endonuclease activity
GO:0004540	RNA nuclease activity

View graph for
Molecular Function

External links

PDB	RCSB:1brn, PDBe:1brn, PDBj:1brn
PDBsum	1brn
PubMed	8110767
UniProt	P00648\|RNBR_BACAM Ribonuclease

[Back to BioLiP]