Structure of PDB 1ai1 Chain L Binding Site BS01

Receptor Information

>1ai1 Chain L (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVMTQSPASLVVSLGQRATISCRASESVDSYGKSFMHWYQQKPGQPPKV
LIYIASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPP
TFGAGTKLEMRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNR

Ligand information

>1ai1 Chain P (length=10) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HIGPGRAFYT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ai1 Structure-based design of a constrained peptide mimic of the HIV-1 V3 loop neutralization site.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Y28 F32 N91 N92 E93 D94
Binding residue (residue number reindexed from 1)	Y32 F36 N95 N96 E97 D98

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0030183	B cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ai1, PDBe:1ai1, PDBj:1ai1
PDBsum	1ai1
PubMed	9054968
UniProt	P01837\|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]