Structure of PDB 8yha Chain K Binding Site BS01

Receptor Information
>8yha Chain K (length=165) Species: 1852835 (Candidatus Cloacimonetes bacterium ADurb.Bin088) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRGTVDFIASLENLKEGDLGILRKLRGARLDEKLPGFDLFSALWWPLRQK
NQRAPKREVAWLIAKLFAEFRFEQREGATLPILMGGICRKLEPKKELPRV
LARFDQLASLDIMQMEEPLSVIMGILRKHQQVCLDWVGLTDVLSFWEQEP
VKREWSDSFIKAYKI
Ligand information
>8yha Chain T (length=47) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacgccaagctttttaacagtggccttattaaatgacttctcctcct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yha Mechanisms for HNH-mediated target DNA cleavage in type I CRISPR-Cas systems
Resolution3.4 Å
Binding residue
(original residue number in PDB)		W46 R49 R54 A55 K96 Q131 S145 F146
Binding residue
(residue number reindexed from 1)		W45 R48 R53 A54 K95 Q130 S144 F145
External links