Structure of PDB 8uxq Chain K Binding Site BS01

Receptor Information
>8uxq Chain K (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL
QEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8uxq Chain I (length=97) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cctggagactagggagtaatccccttggcggttaaaacgcgggggacagc
gcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uxq Structure of human HP1 in complex with H2A.Z nucleosome
Resolution6.3 Å
Binding residue
(original residue number in PDB)
P712 R752 F753 Q754 S755 R785 V786 T787
Binding residue
(residue number reindexed from 1)
P1 R41 F42 Q43 S44 R74 V75 T76
External links
PDB RCSB:8uxq, PDBe:8uxq, PDBj:8uxq
PDBsum8uxq
PubMed
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]