Structure of PDB 8umo Chain K Binding Site BS01

Receptor Information
>8umo Chain K (length=113) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLYIDSEEEQDFLQ
SLSLISWTGILRKGRGQPWVWKEDSIFKPKIADECNCAMMSASGLTADNC
TTLHPYLCKCKFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8umo Structure of the murine CD94-NKG2A receptor in complex with Qa-1 b presenting an MHC-I leader peptide.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S179 S223
Binding residue
(residue number reindexed from 1)		S53 S93
Enzymatic activity
Enzyme Commision number ?
External links