Structure of PDB 8u5h Chain K Binding Site BS01

Receptor Information
>8u5h Chain K (length=110) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
NIQSVLLPKC
Ligand information
>8u5h Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRGGLGWESSLRQRPMPRLTFQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u5h Cryo-EM structure of human DNMT3A N-terminal domain bound to H2AK119Ub nucleosome
Resolution3.23 Å
Binding residue
(original residue number in PDB)		A60 E61 E64 L65 R88 N89 D90 E91
Binding residue
(residue number reindexed from 1)		A51 E52 E55 L56 R79 N80 D81 E82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8u5h, PDBe:8u5h, PDBj:8u5h
PDBsum8u5h
PubMed
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]