Structure of PDB 8tpj Chain K Binding Site BS01

Receptor Information
>8tpj Chain K (length=161) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQDAITAVINSADVQGKYLDGAAMDKLKSYFASGELRVRAASVISANAAT
IVKEAVAKSLLYSDVTRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGD
ASILDERVLNGLKETYNSLGVPISSTVQAIQAIKEVTASLVGADAGKEMG
VYLDYICSGLS
Ligand information
>8tpj Chain S (length=10) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NEVRRFIPQE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tpj Structural and quantum chemical basis for OCP-mediated quenching of phycobilisomes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K58 Y62
Binding residue
(residue number reindexed from 1)		K58 Y62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030089 phycobilisome
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tpj, PDBe:8tpj, PDBj:8tpj
PDBsum8tpj
PubMed38578996
UniProtQ01952|APCB_SYNY3 Allophycocyanin beta chain (Gene Name=apcB)

[Back to BioLiP]