Structure of PDB 8svd Chain K Binding Site BS01

Receptor Information

>8svd Chain K (length=197) Species: 2761578 (Mycolicibacterium baixiangningiae)

DVKGRILDAAADAFMARGFANTTIDDIADEVGATKGLIYYHFRSKFDIFL
AVYEDGMRRVRERVEPHSTAPGTGHQRLEAMSIAHLENLMTELGYHHVVH
QGVRHQDSTALKVRQRDALTALNELRRDYERMFRRVIAEGIADGSLRRVD
EALATRTLLSNLNAVDVWYRKIEGQTGEEIRELASQVVDMLIGGLAD

Ligand information

>8svd Chain M (length=20)

tagatactccggagtatcta

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8svd Structures of The DarR transcription regulator reveal unique modes of second messenger and DNA binding
• Resolution: 3.49 Å
• Binding residue (original residue number in PDB): T32 I33 K44 Y48 S53 K54
• Binding residue (residue number reindexed from 1): T23 I24 K35 Y39 S44 K45

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 05:21:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8svd', asym_id = 'K', bs = 'BS01', title = 'Structures of The DarR transcription regulator r... unique modes of second messenger and DNA binding'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8svd', asym_id='K', bs='BS01', title='Structures of The DarR transcription regulator r... unique modes of second messenger and DNA binding')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '8svd', asym_id = 'K'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='8svd', asym_id='K')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>