Structure of PDB 8qbl Chain K Binding Site BS01

Receptor Information
>8qbl Chain K (length=309) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYT
VEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSI
LNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKI
CCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLS
AQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEK
VGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITY
ISKLEKKYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qbl Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		E35 R38 L39 Y42 F46 Q67 S69 R70 K73 I102 A129 N130 K131 F133 S138 S147 T150 K151 K156 K176 R180 Y184 R188 Y195 A196 D197 D198 K211 F215 I219 T244 G245 H280 G283 W284 F287
Binding residue
(residue number reindexed from 1)		E33 R36 L37 Y40 F44 Q65 S67 R68 K71 I100 A127 N128 K129 F131 S136 S145 T148 K149 K154 K174 R178 Y182 R186 Y193 A194 D195 D196 K209 F213 I217 T242 G243 H278 G281 W282 F285
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0006974 DNA damage response
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8qbl, PDBe:8qbl, PDBj:8qbl
PDBsum8qbl
PubMed38788717
UniProtP23070|RT86_ECOLX Retron Ec86 reverse transcriptase (Gene Name=ret)

[Back to BioLiP]