Structure of PDB 8q7n Chain K Binding Site BS01

Receptor Information

>8q7n Chain K (length=135) Species: 9606 (Homo sapiens)

NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELR
ANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFN
KTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSA

Ligand information

>8q7n Chain 5 (length=115)

acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugaggccuu
gcuuuggcaaggcua

.<<<...<<<<<<<<<<........<<<<<<<<...........>>>>>>
>>...>>>>>>>>>>.......>>>...................<<<<<<
<<....>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): G384 R385 S386 R388 K390
• Binding residue (residue number reindexed from 1): G114 R115 S116 R118 K120

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0001527 microfibril
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005813 centrosome
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
• PDBsum: 8q7n
• PubMed: 38383864
• UniProt: P55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)