Structure of PDB 8pkp Chain K Binding Site BS01

Receptor Information
>8pkp Chain K (length=512) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLT
AQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDSIKSSI
CLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEK
ELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLD
VVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKAN
ELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKT
YGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTN
NSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKI
KAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTY
SAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGCYDF
DVHTMKTLKNII
Ligand information
>8pkp Chain W (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRRKPTRLELKLDDIEEFENIRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pkp High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
Resolution3.2 Å
Binding residue
(original residue number in PDB)		E239 Y242 Y243 P269 V276 E277 A339 H342 A345 Y357 L369 Y373 L376 E377 D401 H406 E407 F413 W444 E445 P446 N449 N450 H453 R456 K457 N478 S480 Y487 S490 L491 F495 F514 M518 E524
Binding residue
(residue number reindexed from 1)		E207 Y210 Y211 P237 V244 E245 A307 H310 A313 Y325 L337 Y341 L344 E345 D369 H374 E375 F381 W412 E413 P414 N417 N418 H421 R424 K425 N446 S448 Y455 S458 L459 F463 F482 M486 E492
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pkp, PDBe:8pkp, PDBj:8pkp
PDBsum8pkp
PubMed
UniProtQ13042|CDC16_HUMAN Cell division cycle protein 16 homolog (Gene Name=CDC16)

[Back to BioLiP]