Structure of PDB 8pki Chain K Binding Site BS01

Receptor Information
>8pki Chain K (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCDKTQRKRCPYCR
FQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL
Ligand information
>8pki Chain I (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgttcaaggccaat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pki Nucleosome-bound NR5A2 structure reveals pioneer factor mechanism by DNA minor groove anchor competition.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		Y96 H97 Y98 K107 K111 R157 R160 R162 R165 Y172
Binding residue
(residue number reindexed from 1)		Y12 H13 Y14 K23 K27 R65 R68 R70 R73 Y80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8pki, PDBe:8pki, PDBj:8pki
PDBsum8pki
PubMed38409506
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]