Structure of PDB 8oue Chain K Binding Site BS01

Receptor Information
>8oue Chain K (length=348) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRI
YNLPPELYHVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSS
RENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRT
VRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSL
GLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQ
SGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGKPEPV
LSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTLECRLQLWWCGGA
Ligand information
>8oue Chain B (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccugcggcggccgcaggaagaggaacggagcgaguccccggggcgcgauu
cccugagcugugggacgugcacccaggacucgcucacacaug
<<<<<<<<.>>>>>>>>..........<<<<<<<<<<....<<<<<<...
<<<........>>>.>>>>>.>...>>>>>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oue 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F171 Y227 R250 H281 I327 Y345 R387 K388 T413 N414 Q415 R483 F485
Binding residue
(residue number reindexed from 1)		F26 Y78 R101 H132 I178 Y196 R238 K239 T264 N265 Q266 R329 F331
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0042393 histone binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0051087 protein-folding chaperone binding
GO:0070034 telomerase RNA binding
GO:0140597 protein carrier chaperone
GO:0140691 RNA folding chaperone
Biological Process
GO:0006281 DNA repair
GO:0007004 telomere maintenance via telomerase
GO:0030576 Cajal body organization
GO:0032203 telomere formation via telomerase
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0034337 RNA folding
GO:0045739 positive regulation of DNA repair
GO:0090666 scaRNA localization to Cajal body
GO:0090671 telomerase RNA localization to Cajal body
GO:1904851 positive regulation of establishment of protein localization to telomere
GO:1904867 protein localization to Cajal body
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000781 positive regulation of double-strand break repair
GO:2001034 positive regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016604 nuclear body
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oue, PDBe:8oue, PDBj:8oue
PDBsum8oue
PubMed38272871
UniProtQ9BUR4|TCAB1_HUMAN Telomerase Cajal body protein 1 (Gene Name=WRAP53)

[Back to BioLiP]