Structure of PDB 8i0r Chain K Binding Site BS01

Receptor Information
>8i0r Chain K (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGK
EDDKIYRGINNYQKYMKRKGPIRAPEHLRATVRWDYQPDICKDYKETGFC
GFGDSCKFLHDRSDYKHGWQIERELDEG
Ligand information
>8i0r Chain G (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggccuccgaacgguaagagccuagcauguagaacugaugaugucauacu
uauccugucccuuuuuuuucc
..................................................
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0r Molecular Basis for the activation of Human spliceosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K203 F213 C217 K218 F219
Binding residue
(residue number reindexed from 1)
K92 F102 C106 K107 F108
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0016567 protein ubiquitination
GO:0034247 snoRNA splicing
GO:0070100 negative regulation of chemokine-mediated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8i0r, PDBe:8i0r, PDBj:8i0r
PDBsum8i0r
PubMed39068178
UniProtO15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)

[Back to BioLiP]