Structure of PDB 8h7q Chain K Binding Site BS01

Receptor Information
>8h7q Chain K (length=107) Species: 1147 (Synechocystis sp. PCC 6714) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYAEIVYKIAQGFVLSKLSSKHDLQWSKCKGNPKLEREYNDKKEKVVNEA
FLAIRSRTEKQAFIDYFVSTLYPHVRQDEFVDFAQKLFQDTDEIRSLTLL
ALSSQYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h7q Cryo-EM structure of Synechocystis sp. PCC6714 Cascade at 3.8 angstrom resolution
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K30 L61
Binding residue
(residue number reindexed from 1)		K21 L52
Enzymatic activity
Enzyme Commision number ?
External links