Structure of PDB 8h7g Chain K Binding Site BS01

Receptor Information
>8h7g Chain K (length=352) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRK
LTVEDFNRALRWSSVEAVCGYGSQEALPMRPYFPEDREVNLVELALATNI
PKGCAETAVRVHVSYLSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKV
ALQDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPH
LCLGPYVRCLVGSVLYCVLEHWTLRDGAALLLSHIFWTHGDLVSGLYQHI
LLSLQKILADPVRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQA
VLDDYSVSNAQVKADGHKVYGAILVAVERLLLLFQESSSGGGAEPSFGSG
LP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h7g Cryo-EM structure of human SAGA transcriptional coactivator complex.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		W276 Q287 W319 K320 A321 R324
Binding residue
(residue number reindexed from 1)		W237 Q248 W280 K281 A282 R285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006282 regulation of DNA repair
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0043484 regulation of RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:1904672 regulation of somatic stem cell population maintenance
Cellular Component
GO:0000118 histone deacetylase complex
GO:0000124 SAGA complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0046695 SLIK (SAGA-like) complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h7g, PDBe:8h7g, PDBj:8h7g
PDBsum8h7g
PubMed36414614
UniProtQ9Y6J9|TAF6L_HUMAN TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L (Gene Name=TAF6L)

[Back to BioLiP]