Structure of PDB 8g8n Chain K Binding Site BS01

Receptor Information
>8g8n Chain K (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTNYFMNWVRQAPGQGLEWMGR
VDPEQGRADYAEKFKKRVTITADKSTSTAYMELSSLRSEDTAVYYCARRA
MDNYGFAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8n XTX101, a tumor-activated, Fc-enhanced anti-CTLA-4 monoclonal antibody, demonstrates tumor-growth inhibition and tumor-selective pharmacodynamics in mouse models of cancer.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T30 N31 F33 R50 D52 R99 D102 Y104
Binding residue
(residue number reindexed from 1)		T30 N31 F33 R50 D52 R99 D102 Y104
External links