Structure of PDB 8ff4 Chain K Binding Site BS01

Receptor Information
>8ff4 Chain K (length=109) Species: 2014529 (Nostoc sp. 'Peltigera membranacea cyanobiont' 210A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSEEDKQYLIFIKVFQQAMKGNFAKIYAKTEEGKDPPIKKKVERLRAELN
YCYDELSFKEYLSDFLVRGGLNKYFNEHQEEIALLIKKSPWQEIRIWSLL
AIASYKPKD
Ligand information
>8ff4 Chain N (length=85) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccgctacgtatcgtagatatatctacgcgtagatatatctacgtttaa
cagtggccttattaaatgacttctccatgatctac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ff4 Molecular mechanism for Tn7-like transposon recruitment by a type I-B CRISPR effector.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
K32 K43 A50 R71
Binding residue
(residue number reindexed from 1)
K29 K40 A47 R68
Enzymatic activity
Enzyme Commision number ?
External links