Structure of PDB 8f4j Chain K Binding Site BS01

Receptor Information
>8f4j Chain K (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>8f4j Chain Y (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f4j Structural evidence for intermediates during O 2 formation in photosystem II.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P20 D23 L35 V43 R46
Binding residue
(residue number reindexed from 1)		P11 D14 L26 V34 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8f4j, PDBe:8f4j, PDBj:8f4j
PDBsum8f4j
PubMed37138085
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]