Structure of PDB 8euy Chain K Binding Site BS01

Receptor Information
>8euy Chain K (length=243) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELLGSDAPLEKVCSALLEYESKRKSLLEDEQDDIEPVWLQLATLKFIGNN
RKLIPYKIAIKNPVIPSSSEACLIVKDPQRVYKDLVNEAGLSKVVTRVIG
LSKLKAKWNSYEQKRQLRDQFDIFLADDRVIPMLPRILGKTFYQKSKVPV
PVKISKGTAEQLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAEN
VESILQFVSKHIVPDGAKGIASIHLKTSQSIAIPLWNNPNLKE
Ligand information
>8euy Chain 6 (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacauguuuuuuuuuaaauauuuuugagaaaauuuguuuu
uuuuuu
...........<<..>>...............<.......>.........
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q56 A58 T59 R67 K68 L69 K92 D93 L117 S118 N125 S126 Y127 E128 D144 R145 V146 P148 M149 P151 R152 G155 Y159 S162 P195 C196 S197 S198 F199 S244 Q245 S246 I247 A248
Binding residue
(residue number reindexed from 1)		Q40 A42 T43 R51 K52 L53 K76 D77 L101 S102 N109 S110 Y111 E112 D128 R129 V130 P132 M133 P135 R136 G139 Y143 S146 P179 C180 S181 S182 F183 S228 Q229 S230 I231 A232
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8euy, PDBe:8euy, PDBj:8euy
PDBsum8euy
PubMed36423630
UniProtQ9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 (Gene Name=SPAC8F11.04)

[Back to BioLiP]