Structure of PDB 8eti Chain K Binding Site BS01

Receptor Information
>8eti Chain K (length=240) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELLGSDAPLEKVCSALLEYESKRKSPVWLQLATLKFIGNNRKLIPYKIAI
KNPVIPSSSEACLIVKDPQRVYKDLVNEAGLSKVVTRVIGLSKLKAKWNS
YEQKRQLRDQFDIFLADDRVIPMLPRILGKTFYQKSKVPVPVKISKGTAE
QLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAENVESILQFVSK
HIVPDGAKGIASIHLKTSQSIAIPLWNNPNLKELIASSRK
Ligand information
>8eti Chain 6 (length=81) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacaugagguguugaacgaaaauuuaaauuuaguuugaaa
ucgauuggugaaaacgguuuuaccacuuugu
........<<<<..>>>>.....<<<....<<<<..>>>>...>>>....
.......<.<<<<....>>>>..>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eti Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
Q56 L57 A58 N66 R67 K68 L69 D93 S118 S126 Y127 E128 D144 R145 V146 P148 M149 P151 R152 G155 K156 S162 C196 S197 S198 Q245 S246 I247 A248
Binding residue
(residue number reindexed from 1)
Q30 L31 A32 N40 R41 K42 L43 D67 S92 S100 Y101 E102 D118 R119 V120 P122 M123 P125 R126 G129 K130 S136 C170 S171 S172 Q219 S220 I221 A222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8eti, PDBe:8eti, PDBj:8eti
PDBsum8eti
PubMed36423630
UniProtQ9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 (Gene Name=SPAC8F11.04)

[Back to BioLiP]