Structure of PDB 8etg Chain K Binding Site BS01

Receptor Information
>8etg Chain K (length=231) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELLGSDAPLEKVCSALLEYESKRKIEPVWLQLATLKFIGNNRKLIPYKIA
IKNPVIPSSSEACLIVKDPQRVYKDLVNEAGLSKVVTRVIGLSKLKAKWN
SYEQKRQLRDQFDIFLADDRVIPMLPRILGKTFYQKSKVPVPVKISKGTA
EQLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAENVESILQFVS
KHIVPDGAKGIASIHLKTSQSIAIPLWNNPN
Ligand information
>8etg Chain 6 (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacaugagguguugaacgaaaauauuuaguuugaaaucgg
ugaaauuuuacc
........<<<<..>>>>.....<<<<...<<..>>..>>>>........
.<<<..>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etg Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
R67 L69 K92 Y127 E128 R145 P148 M149 P151 G155 K156 S162 P195 C196 S198
Binding residue
(residue number reindexed from 1)
R42 L44 K67 Y102 E103 R120 P123 M124 P126 G130 K131 S137 P170 C171 S173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8etg, PDBe:8etg, PDBj:8etg
PDBsum8etg
PubMed36423630
UniProtQ9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 (Gene Name=SPAC8F11.04)

[Back to BioLiP]