Structure of PDB 8edg Chain K Binding Site BS01

Receptor Information
>8edg Chain K (length=74) Species: 7370 (Musca domestica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDNLEVKAKINQGLYKITPRHKGTSFIWNVLADIQKEDDTLVEGWVFCRK
CEKVLKYTTRQTSNLCRHKCCASL
Ligand information
>8edg Chain Q (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agagaacaacaacaagtggcttattttgatacttatgcgccacttg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8edg Zinc-finger BED domains drive the formation of the active Hermes transpososome by asymmetric DNA binding.
Resolution4.64 Å
Binding residue
(original residue number in PDB)
K56 L58 Q64 R70 H71 K72
Binding residue
(residue number reindexed from 1)
K53 L55 Q61 R67 H68 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046872 metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8edg, PDBe:8edg, PDBj:8edg
PDBsum8edg
PubMed37491363
UniProtQ25438

[Back to BioLiP]