Structure of PDB 8dfv Chain K Binding Site BS01

Receptor Information
>8dfv Chain K (length=253) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFT
AMGAGRSKKEAKHAAARALIDKLINPIGWLQEMCMQRRWPPPSYETETEV
GLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETPTQHSN
KVSQFHKTLKNATGKKLLKLQKTCLKNNKIDYIKLLGEIATENQFEVTYV
DIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAADAQRHAAQNALEYLKIM
TKK
Ligand information
>8dfv Chain E (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugagguaguagguuguauaguaguaauuacacaucauacuauacaaccua
cuaccucucu
.<<<<<<<<<<<<<<<<<<<<<<...........>.>>>>>>>>>>>>>>
>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dfv Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		T135 I162 F167 R187 S188 K189 N250 P251 I252 G253 Q256 E257 P278 H279 R281 F283 K299 S300 K301 K305 R306
Binding residue
(residue number reindexed from 1)		T4 I31 F36 R56 S57 K58 N75 P76 I77 G78 Q81 E82 P103 H104 R106 F108 K124 S125 K126 K130 R131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005515 protein binding
GO:0035197 siRNA binding
GO:1905172 RISC complex binding
Biological Process
GO:0007417 central nervous system development
GO:0009047 dosage compensation by hyperactivation of X chromosome
GO:0010468 regulation of gene expression
GO:0010586 miRNA metabolic process
GO:0030422 siRNA processing
GO:0030718 germ-line stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0048132 female germ-line stem cell asymmetric division
GO:0070920 regulation of regulatory ncRNA processing
GO:0070922 RISC complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016442 RISC complex
GO:0070578 RISC-loading complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dfv, PDBe:8dfv, PDBj:8dfv
PDBsum8dfv
PubMed36182693
UniProtQ9VJY9|LOQS_DROME Protein Loquacious (Gene Name=loqs)

[Back to BioLiP]