Structure of PDB 8dej Chain K Binding Site BS01

Receptor Information
>8dej Chain K (length=117) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSLDPARTDRPYLLGRLFAVLEKAQEDAVPGANATIKDRYLASASANPGQ
VFHMLLKNASNHTAKLRKDPERKAIHYEIMMQEIIDNISDFPVTMSSDEQ
GLFMIGYYHQRKALFTK
Ligand information
>8dej Chain M (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggaggagttttcgccatgctcagactggcgagttcgcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dej Structural snapshots of R-loop formation by a type I-C CRISPR Cascade.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		F117 K119
Binding residue
(residue number reindexed from 1)		F115 K117
Enzymatic activity
Enzyme Commision number ?
External links