Structure of PDB 8cef Chain K Binding Site BS01

Receptor Information
>8cef Chain K (length=88) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEI
TKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
Resolution2.486 Å
Binding residue
(original residue number in PDB)		A98 R105 K129 Q132 R135 R155 G156 G157 R158
Binding residue
(residue number reindexed from 1)		A25 R32 K56 Q59 R62 R82 G83 G84 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum8cef
PubMed37503845
UniProtO08580|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]