Structure of PDB 8c6j Chain K Binding Site BS01

Receptor Information
>8c6j Chain K (length=295) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQV
DSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAI
KEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNS
GAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEA
LYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERR
Ligand information
>8c6j Chain 2 (length=142) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuauc
aguuuaauauauauuaaauggauuuuuggagcagggagauggaguccacu
ccacgcaucgaccugguauugcaguaccuccaggaacggugc
..................................................
...<<<<<<..>>>>>>.................<<<<.<<<<.>>>>>>
>>..<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c6j Regulation of 3' splice site selection after step 1 of splicing by spliceosomal C* proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K246 I247 N256 A257 K258 Y260 I262
Binding residue
(residue number reindexed from 1)		K206 I207 N216 A217 K218 Y220 I222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0005112 Notch binding
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0019899 enzyme binding
GO:0042809 nuclear vitamin D receptor binding
GO:0042974 nuclear retinoic acid receptor binding
GO:0046332 SMAD binding
GO:0050681 nuclear androgen receptor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000398 mRNA splicing, via spliceosome
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043923 positive regulation by host of viral transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0048384 retinoic acid receptor signaling pathway
GO:0048385 regulation of retinoic acid receptor signaling pathway
GO:0050769 positive regulation of neurogenesis
GO:0070562 regulation of vitamin D receptor signaling pathway
GO:0070564 positive regulation of vitamin D receptor signaling pathway
GO:0071300 cellular response to retinoic acid
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0008024 cyclin/CDK positive transcription elongation factor complex
GO:0016363 nuclear matrix
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c6j, PDBe:8c6j, PDBj:8c6j
PDBsum8c6j
PubMed36867703
UniProtQ13573|SNW1_HUMAN SNW domain-containing protein 1 (Gene Name=SNW1)

[Back to BioLiP]