Structure of PDB 7z6h Chain K Binding Site BS01

Receptor Information
>7z6h Chain K (length=439) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQGGSILLIT
GPPGCGKTTTLKILSKEHGIQVQEWINPVLPYQSQIAVFKEFLLRATKYN
KLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFI
ISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLNRIVTIEA
NKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKAIGGKDVSLFL
FRALGKILYCKRASLTELDSPRLPSHLSEYERDTLLVEPEEVVEMSHMPG
DLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTS
IATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKAL
FPDLCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z6h Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
Resolution3.59 Å
Binding residue
(original residue number in PDB)		Y189 Q231 R234 D265 R269 N288 A291 P292 T293 L396 W484 F521 L524 K526 F530 R537
Binding residue
(residue number reindexed from 1)		Y82 Q124 R127 D158 R162 N181 A184 P185 T186 L250 W338 F375 L378 K380 F384 R391
Enzymatic activity
Enzyme Commision number 3.1.11.2: exodeoxyribonuclease III.
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003684 damaged DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
GO:0140463 chromatin-protein adaptor activity
Biological Process
GO:0000076 DNA replication checkpoint signaling
GO:0000077 DNA damage checkpoint signaling
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006974 DNA damage response
GO:0008156 negative regulation of DNA replication
GO:0021762 substantia nigra development
GO:0031573 mitotic intra-S DNA damage checkpoint signaling
GO:0033314 mitotic DNA replication checkpoint signaling
GO:0042325 regulation of phosphorylation
GO:0051598 meiotic recombination checkpoint signaling
GO:0071479 cellular response to ionizing radiation
GO:1990166 protein localization to site of double-strand break
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0030896 checkpoint clamp complex
GO:0031389 Rad17 RFC-like complex
GO:0035861 site of double-strand break
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z6h, PDBe:7z6h, PDBj:7z6h
PDBsum7z6h
PubMed35819203
UniProtO60671|RAD1_HUMAN Cell cycle checkpoint protein RAD1 (Gene Name=RAD1);
O75943

[Back to BioLiP]