Structure of PDB 7xhn Chain K Binding Site BS01

Receptor Information

>7xhn Chain K (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTA
ELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLK
EDLEREQRWLDEQQQIMESLNVLHSELKNKVETFSESRIFNELKTKMLNI
KEYKEKLLSTLGEFLEDHFPLPSSVNLITLHEMLEILINRLPYVKISDSF
WPPYVELLLRNGIALRHPEDPTRIRLEAFH

Ligand information

>7xhn Chain o (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GVLAHLERLETQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7xhn Structural insights into human CCAN complex assembled onto DNA.
Resolution	3.71 Å
Binding residue (original residue number in PDB)	S109 T110
Binding residue (residue number reindexed from 1)	S90 T91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0000070	mitotic sister chromatid segregation
GO:0007059	chromosome segregation
GO:0051382	kinetochore assembly

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000939	inner kinetochore
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xhn, PDBe:7xhn, PDBj:7xhn
PDBsum	7xhn
PubMed	36085283
UniProt	Q9BS16\|CENPK_HUMAN Centromere protein K (Gene Name=CENPK)

[Back to BioLiP]