Structure of PDB 7xfj Chain K Binding Site BS01

Receptor Information
>7xfj Chain K (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPE
DEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLL
RALEPLEGLETMRQLRSTVLKDRELCSGPSKLCQALAINKSFDQRDLAQD
EAVWLERGPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD
Ligand information
>7xfj Chain I (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgacacgcgcctggagactagggagtaatccccttggcggttaaaacgc
gggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgacc
aattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfj Structural and mechanistic insights into the DNA glycosylase AAG-mediated base excision in nucleosome.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y159 I161 Y162 Y165 P218 S219
Binding residue
(residue number reindexed from 1)		Y78 I80 Y81 Y84 P129 S130
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0005515 protein binding
GO:0008725 DNA-3-methyladenine glycosylase activity
GO:0016787 hydrolase activity
GO:0019104 DNA N-glycosylase activity
GO:0043916 DNA-7-methylguanine glycosylase activity
GO:0052821 DNA-7-methyladenine glycosylase activity
GO:0052822 DNA-3-methylguanine glycosylase activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006307 DNA alkylation repair
GO:0045007 depurination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xfj, PDBe:7xfj, PDBj:7xfj
PDBsum7xfj
PubMed37339965
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]