Structure of PDB 7w5x Chain K Binding Site BS01

Receptor Information
>7w5x Chain K (length=107) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTL
GDYIRQRRLLLAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTP
SDYRHRL
Ligand information
>7w5x Chain 1 (length=75) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgcacgggtggataagcgtttacagttttcgcaagctcgtaaaagcag
tataatgggagctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w5x Structural basis of three different transcription activation strategies adopted by a single regulator SoxS.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Y33 S34 W36 Y37 R55 G81 Y82 V83 T87 R94
Binding residue
(residue number reindexed from 1)		Y33 S34 W36 Y37 R55 G81 Y82 V83 T87 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5x, PDBe:7w5x, PDBj:7w5x
PDBsum7w5x
PubMed36243985
UniProtP0A9E2|SOXS_ECOLI Regulatory protein SoxS (Gene Name=soxS)

[Back to BioLiP]