Structure of PDB 7v01 Chain K Binding Site BS01

Receptor Information
>7v01 Chain K (length=117) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTFAHEVVKSNVKNQVLFNGLTTSKLRNLMEQVNRLYTIAFNSNEDQLNE
EFIDELEYLKIKFYYEAGREKSVDEFLKKTLMFPIIDRVIKKESKKFFLD
YCKYFEALVAYAKYYQK
Ligand information
>7v01 Chain U (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuauauacuucggcuacguguuc
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v01 Structures of an active type III-A CRISPR effector complex.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		T44 S46 K47 R49 M52 Y87 R91 K135
Binding residue
(residue number reindexed from 1)		T22 S24 K25 R27 M30 Y65 R69 K113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7v01, PDBe:7v01, PDBj:7v01
PDBsum7v01
PubMed35714601
UniProtQ5HK90

[Back to BioLiP]