Structure of PDB 7uzy Chain K Binding Site BS01

Receptor Information
>7uzy Chain K (length=59) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLTTSKLRNLMEQVNRLYEEFIDELEYLKIKFYYEAGREKSVDEFLKKTL
MFPIIDRVI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uzy Structures of an active type III-A CRISPR effector complex.
Resolution4.05 Å
Binding residue
(original residue number in PDB)
S46 K47 Y87 R91
Binding residue
(residue number reindexed from 1)
S5 K6 Y34 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7uzy, PDBe:7uzy, PDBj:7uzy
PDBsum7uzy
PubMed35714601
UniProtQ5HK90

[Back to BioLiP]