Structure of PDB 7u50 Chain K Binding Site BS01

Receptor Information
>7u50 Chain K (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDIL
CLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKV
SYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAF
RKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGE
LLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLL
PALCDSKIRSKALGSDHCPITLYLAL
Ligand information
>7u50 Chain I (length=144) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagca
ccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagggg
attactccctagtctccaggcacgtgtcagatatatccatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u50 Structural basis for APE1 processing DNA damage in the nucleosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		E96 Y128 Y171 N174 R177 N212 N226 N229 F266 T268 W280 L282
Binding residue
(residue number reindexed from 1)		E54 Y86 Y129 N132 R135 N170 N184 N187 F224 T226 W238 L240
Enzymatic activity
Enzyme Commision number 3.1.11.2: exodeoxyribonuclease III.
3.1.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003691 double-stranded telomeric DNA binding
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0004527 exonuclease activity
GO:0004528 phosphodiesterase I activity
GO:0004844 uracil DNA N-glycosylase activity
GO:0005515 protein binding
GO:0008081 phosphoric diester hydrolase activity
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008309 double-stranded DNA exodeoxyribonuclease activity
GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0016491 oxidoreductase activity
GO:0016890 site-specific endodeoxyribonuclease activity, specific for altered base
GO:0031490 chromatin DNA binding
GO:0046872 metal ion binding
GO:0052720 class II DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0090580 phosphodiesterase activity, acting on 3'-phosphoglycolate-terminated DNA strands
GO:0140431 DNA-(abasic site) binding
Biological Process
GO:0000723 telomere maintenance
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006287 base-excision repair, gap-filling
GO:0006308 DNA catabolic process
GO:0006310 DNA recombination
GO:0042981 regulation of apoptotic process
GO:0043488 regulation of mRNA stability
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0097698 telomere maintenance via base-excision repair
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005813 centrosome
GO:0005840 ribosome
GO:0016607 nuclear speck
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u50, PDBe:7u50, PDBj:7u50
PDBsum7u50
PubMed36104361
UniProtP27695|APEX1_HUMAN DNA repair nuclease/redox regulator APEX1 (Gene Name=APEX1)

[Back to BioLiP]