Structure of PDB 7sba Chain K Binding Site BS01

Receptor Information
>7sba Chain K (length=146) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTEKLKLTKRLVEEYRRFYQVELSKKPSTHAILLPLSKALEQILSVPDDW
DEEELILQGSGQLQAALDRQEVYTRPIIKDKSVAYETRQLQELEAIQIFM
TTCVRDLFGEMCKGDRAILQEQRNRIKSGAEFAYRLLALEAQQNQN
Ligand information
>7sba Chain Z (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugaaacgauuguugugccccuggcggucgcuuucaaugccu
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sba Structural rearrangements allow nucleic acid discrimination by type I-D Cascade.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H30 R69
Binding residue
(residue number reindexed from 1)		H30 R69
Enzymatic activity
Enzyme Commision number ?
External links