Structure of PDB 7r6q Chain K Binding Site BS01

Receptor Information
>7r6q Chain K (length=286) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPRERVIKAVNELIKFTSKPKNLLEDDEEELKKDLQLIVVNNKSFTGTS
KSFKLKLLNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFD
QLDSEGIKVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPK
LMGGKAYNKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGT
TLNVHLGNLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLY
YNQDVLDELEDGVQVHLSTFNKGLMEIANPSELGSI
Ligand information
>7r6q Chain 6 (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa
......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..........<<<<..>>>>................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		V83 K93 F95 K96 K128 D129 K161 K165 Y167 E168 D184 S185 V187 T188 S189 P191 K192 G196 K201 R210 N214 T221 N224 K228 P239 R240 T242 T243 N245 R277 N284 R285 S286 P287
Binding residue
(residue number reindexed from 1)		V41 K51 F53 K54 K86 D87 K119 K123 Y125 E126 D142 S143 V145 T146 S147 P149 K150 G154 K159 R168 N172 T179 N182 K186 P197 R198 T200 T201 N203 R235 N242 R243 S244 P245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum7r6q
PubMed36482249
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]