Structure of PDB 7ohq Chain K Binding Site BS01

Receptor Information
>7ohq Chain K (length=252) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPRERVIKAVNELIKFTSKPEEELKKDLQLIVVNNKSFTGTSKSFKLKL
LNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFDQLDSEGI
KVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPKLMGGKAY
NKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGTTLNVHLG
NLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLYYNQDVLD
EL
Ligand information
>7ohq Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ohq Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N84 K93 F95 K96 K128 D129 K161 K165 Y167 E168 R170 D184 S185 V187 T188 S189 P191 K192 G195 G196 K197 K201 R210 A213 T220 T221 N224 K228 K237 P239 R240 T242 T243 N245 R277 K282 N284 R285
Binding residue
(residue number reindexed from 1)		N35 K44 F46 K47 K79 D80 K112 K116 Y118 E119 R121 D135 S136 V138 T139 S140 P142 K143 G146 G147 K148 K152 R161 A164 T171 T172 N175 K179 K188 P190 R191 T193 T194 N196 R228 K233 N235 R236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohq, PDBe:7ohq, PDBj:7ohq
PDBsum7ohq
PubMed34813592
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]