Structure of PDB 7ohp Chain K Binding Site BS01

Receptor Information
>7ohp Chain K (length=239) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPRERVIKAVNELIKFTSEELKKDLQLIVVNNKSFTGTSKSFKLKLLNV
KHSFYKPWKEASATAVKDFKVLLILKDSDIKDDLFDQLGIKVDEIICGKD
LKTVYKAYEARNAFISQFSLILADDSIVTSLPKLMGGKAYNKVETTPISI
RTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGTTLNVHLGNLEWLRPEEF
VDNVELISEQLIKAYQIRSIFIKTNRSPVLPLYYNQDVL
Ligand information
>7ohp Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<.....>>>>>.....<<<<.<.<<<<....>>>>>.>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ohp Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		L74 K75 N84 K93 F95 K96 K161 K165 Y167 E168 D184 S185 I186 V187 T188 S189 K192 G196 Y199 N200 K201 R210 N214 K215 S218 T221 N224 K228 K237 P239 R240 T242 T243 N245 H247 R277 N284 R285
Binding residue
(residue number reindexed from 1)		L22 K23 N32 K41 F43 K44 K102 K106 Y108 E109 D125 S126 I127 V128 T129 S130 K133 G137 Y140 N141 K142 R151 N155 K156 S159 T162 N165 K169 K178 P180 R181 T183 T184 N186 H188 R218 N225 R226
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohp, PDBe:7ohp, PDBj:7ohp
PDBsum7ohp
PubMed34813592
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]