Structure of PDB 7mpl Chain K Binding Site BS01

Receptor Information

>7mpl Chain K (length=205) Species: 38323 (Bartonella henselae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TEIRVHQGDLPNLDNYRIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTAD
VIQIAKGQKSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFC
TKIASKLTRTYTDRHGLKEICGELLNVNISKQQQSSDWAAETLSRAQIEY
AASDVLYLHRLKDIFEERLKREERESVAKACFQFLPMRANLDLLGWSEID
IFAHS

Ligand information

>7mpl Chain H (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7mpl Structural characterization of NrnC identifies unifying features of dinucleotidases.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	Y112 T113 D114
Binding residue (residue number reindexed from 1)	Y111 T112 D113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0004527	exonuclease activity
GO:0008408	3'-5' exonuclease activity

	Biological Process
GO:0006139	nucleobase-containing compound metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7mpl, PDBe:7mpl, PDBj:7mpl
PDBsum	7mpl
PubMed	34533457
UniProt	X5MEI1

[Back to BioLiP]