Structure of PDB 7m5c Chain K Binding Site BS01

Receptor Information
>7m5c Chain K (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEQVAQDTEEVFRSYVFYRHQQEQEADPEMVTLPTMGQVGRQLAIIGDD
INRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGF
GYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAAL
Ligand information
>7m5c Chain L (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSTMGQVGRQLAIIGDDINRRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5c Structural basis of BAK activation in mitochondrial apoptosis initiation.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		D84 I85 R88 Y89 E92 T95 M96 H99 I114 S117 L118 N124 G126 R127 F134
Binding residue
(residue number reindexed from 1)		D50 I51 R54 Y55 E58 T61 M62 H65 I80 S83 L84 N90 G92 R93 F100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7m5c, PDBe:7m5c, PDBj:7m5c
PDBsum7m5c
PubMed35017502
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]