Structure of PDB 7kbf Chain K Binding Site BS01

Receptor Information
>7kbf Chain K (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPPTLSMVVEVLKKNTERKGTSVQAIRTRILSAHPTVDPLRLKFLLRTAL
NKGLEKGILIRPLNSSATGATGRFKLAK
Ligand information
>7kbf Chain I (length=172) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttggccagctaggatatcacaatcccggtgccgaggccgctcaattggtc
gtagacagctctagcaccgcttaaacgcacgtacggaatccgtacgtgcg
tttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccg
ggattgtgatatcctagctggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kbf Structural features of nucleosomes in interphase and metaphase chromosomes.
Resolution4.42 Å
Binding residue
(original residue number in PDB)		R58 R67 L80 R81 K83 R87
Binding residue
(residue number reindexed from 1)		R18 R27 L40 R41 K43 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kbf, PDBe:7kbf, PDBj:7kbf
PDBsum7kbf
PubMed34478647
UniProtP15308|B4_XENLA Protein B4 (Gene Name=b4)

[Back to BioLiP]