Structure of PDB 7fdl Chain K Binding Site BS01

Receptor Information
>7fdl Chain K (length=136) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKKQLAVSVRNIQWSYGIFWLEWGDGYYNGDERSEQLRELYESLSLDTEW
YYLVCMSFVFNIGEGIPGGALSNGEPIWLCNAETADSKVFTRSLLAKSAS
LQTVVCFPFLGGVLEIGTTEHIKEDMNVIQSVKTLF
Ligand information
>7fdl Chain L (length=14) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TEQEEDLIIRLHKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fdl Structural insights into partner selection for MYB and bHLH transcription factor complexes.
Resolution2.897 Å
Binding residue
(original residue number in PDB)		L84 S85 S123 L160 L161
Binding residue
(residue number reindexed from 1)		L44 S45 S57 L94 L95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7fdl, PDBe:7fdl, PDBj:7fdl
PDBsum7fdl
PubMed35995835
UniProtQ9CAD0|EGL1_ARATH Transcription factor EGL1 (Gene Name=BHLH2)

[Back to BioLiP]