Structure of PDB 7eda Chain K Binding Site BS01

Receptor Information
>7eda Chain K (length=37) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>7eda Chain Y (length=27) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eda Cryo-EM structure of monomeric photosystem II at 2.78 angstrom resolution reveals factors important for the formation of dimer.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		P20 L21 D23 V24 L35 W39 A42 V43 R46
Binding residue
(residue number reindexed from 1)		P11 L12 D14 V15 L26 W30 A33 V34 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eda, PDBe:7eda, PDBj:7eda
PDBsum7eda
PubMed34216574
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]