Structure of PDB 7d7d Chain K Binding Site BS01

Receptor Information
>7d7d Chain K (length=71) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGI
IEKIQSEAIDENLLRPSVVRC
Ligand information
>7d7d Chain N (length=48) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
taaagagctcagcactattactgagagtataaagatactgaagcagcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d7d Transcription activation by a sliding clamp.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		T71 Q72
Binding residue
(residue number reindexed from 1)		T40 Q41
Enzymatic activity
Catalytic site (original residue number in PDB) R101
Catalytic site (residue number reindexed from 1) R70
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0140537 transcription regulator activator activity
Biological Process
GO:0010468 regulation of gene expression
GO:0019086 late viral transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7d7d, PDBe:7d7d, PDBj:7d7d
PDBsum7d7d
PubMed33602900
UniProtP13338|LTACT_BPT4 Late transcription coactivator (Gene Name=33)

[Back to BioLiP]