Structure of PDB 7c97 Chain K Binding Site BS01

Receptor Information
>7c97 Chain K (length=67) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELKSLTEIKDVL
ASRGLSLGMRLENWPPA
Ligand information
>7c97 Chain G (length=48) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccctgcatccgtgatagacaatttaacacttttgtcaatcattttgtt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c97 Structural basis for transcription inhibition by E. coli SspA
Resolution3.68 Å
Binding residue
(original residue number in PDB)		R265 K298 S299
Binding residue
(residue number reindexed from 1)		R16 K41 S42
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006879 intracellular iron ion homeostasis
GO:0009408 response to heat
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0036460 cellular response to cell envelope stress
GO:0042128 nitrate assimilation
GO:0044780 bacterial-type flagellum assembly
GO:0048870 cell motility
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0090605 submerged biofilm formation
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c97, PDBe:7c97, PDBj:7c97
PDBsum7c97
PubMed
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]