Structure of PDB 7bqx Chain K Binding Site BS01

Receptor Information
>7bqx Chain K (length=68) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PELMWAPSLRNSLRVSPEALELAEREAERARSERWDRCAQVLKNRLLRVE
LDGIMRDHLARAEEIRQD
Ligand information
>7bqx Chain O (length=29) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RFVSQLRRKLERSTHRLIADLERLKFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bqx CryoEM structure of the tegumented capsid of Epstein-Barr virus.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		L66 R67 L70 M74 H77 I84 D87
Binding residue
(residue number reindexed from 1)		L47 R48 L51 M55 H58 I65 D68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bqx, PDBe:7bqx, PDBj:7bqx
PDBsum7bqx
PubMed32620850
UniProtP03233|CVC2_EBVB9 Capsid vertex component 2 (Gene Name=CVC2)

[Back to BioLiP]