Structure of PDB 7abg Chain K Binding Site BS01

Receptor Information

>7abg Chain K (length=123) Species: 9606 (Homo sapiens)

NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELR
ANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFN
KTILPKVMQVKNFGRSGRTKYTH

Ligand information

>7abg Chain 5 (length=114)

acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugagccuug
ccuuggcaaggcua

.<<<...<<<<<<<<<<........<<<<<<<<.<.......>.>>>>>>
>>...>>>>>>>>>>.......>>>..................<<<<<<<
<....>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7abg Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
• Resolution: 7.8 Å
• Binding residue (original residue number in PDB): N382 F383 R385 S386
• Binding residue (residue number reindexed from 1): N112 F113 R115 S116

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0001527 microfibril
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005813 centrosome
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:7abg, PDBe:7abg, PDBj:7abg
• PDBsum: 7abg
• PubMed: 33243851
• UniProt: P55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)