Structure of PDB 6w6v Chain K Binding Site BS01

Receptor Information
>6w6v Chain K (length=79) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIMLP
EQLKSGKFCSHCGCVYVPNFNASLQLTTN
Ligand information
>6w6v Chain A (length=294) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auccaugaccaaagaaucgucacaaaucgaagcuuacaaaauggaguaaa
auuuuacucaguaauaugcuuuggguugaaagucucccaccaauucguau
gcggaaaacguaaugagauuuaaaaauaaaucaacucauuaaggaggaug
ccgguauucugcuucuugaccugguaccucuaggguacugguguucggua
cuggauuccgauggaaucuaaaccauaguuaugacgauugcucuuuccug
gaucgaguaacccaauggagcuuacuauucuugguccauggauu
<<<<<<<<<<<<<.<<<<<<<......<<<<<<..........<<<<<<<
..>>>>>>>........>>>>>>{......[[.((((.<<<.........
<<<.....>>><<<<<<.................>>>>>>.<<.<<<<<<
<<>>>>>>>>.>>.......<<<<<<<<.<<>>>>>>>>>>.....>>>.
..<<<<<<<...>>>>>>>.............>>>>>>><<<<..<<<.>
>>..>>>>...}....))))]]...>....>>>>>>.>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w6v Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H41 K45
Binding residue
(residue number reindexed from 1)		H39 K43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004518 nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0030541 plasmid partitioning
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6v, PDBe:6w6v, PDBj:6w6v
PDBsum6w6v
PubMed32651392
UniProtP40993|RMRP_YEAST Ribonuclease MRP protein subunit SNM1 (Gene Name=SNM1)

[Back to BioLiP]